Protein or peptide name:	MntS
Chromosome:	str. K-12 substr. MG1655, complete genome
Protein or peptide start site:	852869
Protein or peptide end site:	852997
ncRNA start site:	852869
ncRNA end site:	852997
Genome Browser:	NA
Protein or peptide sequence:	MNEFKRCMRVFSHSPFKVRLMLLSMLCDMVNNKPQQDKPSDK
Protein or peptide length:	42aa
ncRNA type:	ncRNA
ncRNA name:	mntS
Entrez ID:	14678509
Experimental species:	Escherichia coli
Experimental techniques:	Western blotting
Experimental sample (cell line and/or tissue):	E. coli
Description:	mntS (formerly the small RNA gene rybA) is repressed by manganese through MntR and encodes an unannotated 42-amino-acid protein.
Subcellular location:	NA
Function:	Bacteria control intracellular manganese levels by the transcription regulator MntR.
Title of paper:	The Escherichia coli MntR miniregulon includes genes encoding a small protein and an efflux pump required for manganese homeostasis
PMID:	21908668
Year of publication:	2011